PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0670s0090.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 676aa    MW: 74048.3 Da    PI: 6.4743
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0670s0090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.9e-094174541954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  SapurV1A.0670s0090.1.p 417 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 454
                             664459******************************88 PP

2BELL129.71e-41279350172
                    BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             erqelq+k +kLls+l+eVd+rYkqy++q+q+v+ssF+++ag+g+akpY++lAl++iSrhFrcL+dai++qi
  SapurV1A.0670s0090.1.p 279 ERQELQNKLTKLLSMLDEVDRRYKQYYHQMQIVVSSFDVIAGCGAAKPYIALALQTISRHFRCLRDAITGQI 350
                             79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-64203348IPR006563POX domain
PfamPF075263.7E-50209347IPR006563POX domain
PROSITE profilePS5007112.163395458IPR001356Homeobox domain
SMARTSM003891.0E-9398462IPR001356Homeobox domain
CDDcd000864.41E-13398459No hitNo description
SuperFamilySSF466892.61E-17399465IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-29401464IPR009057Homeodomain-like
PfamPF059204.6E-18415454IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MATYYTSSNN QRDAAAMVYL PGSYPEAPVL PGNIMMYMNS GSYSDNLAGN PHHQNNCIEF  60
QSVENSGSTP QQQEILSNLG GSRIGEHDFG AWRDGRNEML VMHSVSGASS ILHGAQSLQG  120
QGLSLSLGTQ IPSGMQMPSI PYRNTNPGLT SFLTPISSIS GEGGGRNGSS RDEQSRNIEY  180
LTPGFSGGNH DVNKGDLSLY GMNSTGRTIP NPKYLKAAQQ LLDEVVNVRK AIKQPDKEKN  240
QTMSEYGLNS AKAGDSRSKN GAPNPQESTD SPSELSHAER QELQNKLTKL LSMLDEVDRR  300
YKQYYHQMQI VVSSFDVIAG CGAAKPYIAL ALQTISRHFR CLRDAITGQI RAARNNLGEQ  360
ETSENSKGVG ISRLRFVDQQ LRQQRALQQL GMMKQHAWRP QRGLPESSVS ILRAWLFEHF  420
LHPYPKDSDK IMLARQTGLT RSQVSNWFIN ARVRLWKPMV EEMYKEELGD AEMDSNSSSE  480
NAAKATKGDG TSEEKGEEFQ HSASSTATGR CIVGQLMDSK SDHVPEVEMA GLTARNNFHN  540
GIRGETFTEY GLLKLRENQR PSMEDCSLFS DAMAHSEGGG DRFMAAAAAA YQMPEVGRFE  600
NGSGVSLTLG LQHCEGGSLP MSGTAHHGFV SMRGDDDIYN AASSVGAEPT DFECLNPGNR  660
QQRFSSSHVF HDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-17404461158Homeobox protein Meis1
4xrs_B5e-17404461158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037163.10.0PREDICTED: BEL1-like homeodomain protein 6
SwissprotO656851e-143BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLB9H0U80.0B9H0U8_POPTR; Uncharacterized protein
STRINGPOPTR_0004s16660.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21463179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-133BEL1-like homeodomain 7